PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.375180.1
Common NameCsa_3G303630, LOC101222180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 167aa    MW: 19001.8 Da    PI: 9.8937
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.375180.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G   +W+++++  g+ R++k+c++rw +yl
   Cucsa.375180.1 14 KGPWTSEEDKKLINFIVTNGQScCWRAVPKLAGLLRCGKSCRLRWTNYL 62
                     79******************99***********99************97 PP

2Myb_DNA-binding51.72e-1675112847
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
   Cucsa.375180.1  75 EEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 112
                      999************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-19563IPR009057Homeodomain-like
PROSITE profilePS5129413.142962IPR017930Myb domain
SuperFamilySSF466891.76E-2511109IPR009057Homeodomain-like
SMARTSM007171.5E-101364IPR001005SANT/Myb domain
PfamPF002491.2E-131462IPR001005SANT/Myb domain
CDDcd001671.09E-71662No hitNo description
PROSITE profilePS5129424.9963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2464117IPR009057Homeodomain-like
SMARTSM007171.7E-1367115IPR001005SANT/Myb domain
PfamPF002494.8E-1475112IPR001005SANT/Myb domain
CDDcd001671.61E-1175113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTSE EDKKLINFIV TNGQSCCWRA VPKLAGLLRC GKSCRLRWTN  60
YLRPDLKRGL LSDFEEKMVI DLHAQLGNRW SKIASHLPGR TDNEIKNHWN THIKKKLRKM  120
GIDPQTHKHI SISTDSHQSN LPSSHLDTEM SPSSPVNNIP ETKDPGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818541e-125LN681854.1 Cucumis melo genomic scaffold, anchoredscaffold00042.
GenBankLN7132601e-125LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004145848.11e-121PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-80ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A0L7231e-121A0A0A0L723_CUCSA; Uncharacterized protein
STRINGSolyc11g011050.1.15e-86(Solanum lycopersicum)
STRINGGLYMA11G33620.16e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-89myb domain protein 20
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]